PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_012572557.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

SBP

Protein Properties

Length: 121aa MW: 13951.5 Da PI: 7.7902

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_012572557.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	135.2	2.1e-42	43	120	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqve+C+adlseak+yhrrhkvCe h+kap+v +sgl+qrfCqqCsrfhelsefD++krsCrrrLa+hn rrrk+++ XP_012572557.1 43 CCQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHISGLQQRFCQQCSRFHELSEFDDSKRSCRRRLAEHNLRRRKNAN 120 6**************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.6E-35	38	105	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.342	41	118	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	6.02E-38	42	119	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	6.5E-34	44	117	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MERSEEKWSL VDEEEEESGE EGIKKRVVKG SKGAGGSSNI ATCCQVENCD ADLSEAKQYH 60 RRHKVCEYHA KAPAVHISGL QQRFCQQCSR FHELSEFDDS KRSCRRRLAE HNLRRRKNAN 120 D

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-36	33	117	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_012572557.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT142442	7e-79	BT142442.1 Medicago truncatula clone JCVI-FLMt-8F22 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012572557.1	3e-84	squamosa promoter-binding protein 1
Swissprot	Q38741	3e-43	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A1S3E9Q2	6e-83	A0A1S3E9Q2_CICAR; squamosa promoter-binding protein 1
STRING	XP_004505078.1	1e-83	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	7e-33	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]