PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_012574949.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

MYB_related

Protein Properties

Length: 95aa MW: 11325.1 Da PI: 10.2332

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_012574949.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.2	4e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg WT+eEd++l+d+v+++G +W++ ++ g+ R++k+c++rw++yl XP_012574949.1 14 RGTWTQEEDKKLIDYVTRYGHWNWRLLPKFAGLARCGKSCRLRWLNYL 61 89****************99***********************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.1E-23	7	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.796	9	65	IPR017930	Myb domain
SMART	SM00717	3.9E-11	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	6.0E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.33E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	1.64E-9	16	61	No hit	No description
PROSITE profile	PS50090	4.066	62	92	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.6E-7	65	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MVRIPSSDKI VLKRGTWTQE EDKKLIDYVT RYGHWNWRLL PKFAGLARCG KSCRLRWLNY 60 LSPNLKRGNF TLEEEETIVK LNQLLGNRTQ DYLLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-16	12	88	5	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_012574949.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027185992.1	5e-60	transcription factor MYB13-like
Swissprot	Q7XBH4	4e-37	MYB4_ORYSJ; Transcription factor MYB4
TrEMBL	A0A3Q7Y6C0	1e-58	A0A3Q7Y6C0_CICAR; transcription factor MYB13-like
STRING	XP_007132610.1	7e-48	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G06180.1	3e-39	myb domain protein 13

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661]