PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_013587672.1

Organism

Brassica oleracea

Taxonomic ID

3712

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

HB-other

Protein Properties

Length: 87aa MW: 10427.9 Da PI: 9.4344

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013587672.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	50.3	4.1e-16	3	40	17	54
HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 ++F ++++p++++r +L++klgL rqVk+WFqNrR++ XP_013587672.1 3 TYFSECQHPDKKQRMQLSRKLGLVPRQVKFWFQNRRIQ 40 69**********************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	5.0E-4	1	48	IPR001356	Homeobox domain
PROSITE profile	PS50071	14.252	1	44	IPR001356	Homeobox domain
Pfam	PF00046	1.4E-13	3	40	IPR001356	Homeobox domain
SuperFamily	SSF46689	7.94E-13	3	43	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	9.1E-15	4	47	IPR009057	Homeodomain-like
CDD	cd00086	9.82E-10	4	38	No hit	No description
PRINTS	PR00031	2.9E-5	15	24	IPR000047	Helix-turn-helix motif
PRINTS	PR00031	2.9E-5	24	40	IPR000047	Helix-turn-helix motif

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MLTYFSECQH PDKKQRMQLS RKLGLVPRQV KFWFQNRRIQ KAQQERADSS ALKEESDRIR 60 CENTAIREAY EHTICHNCAR EGFKHCS

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in all cells at the 4- and 16-cell embryo stages. Expression is restricted to the protoderm from the globular stage onward. {ECO:0000269\|PubMed:25564655}.
Uniprot	TISSUE SPECIFICITY: Expressed in apical meristems and young epidermal tissue including trichomes and stipules. Expressed in lateral root tips, the L1 layer of apical inflorescence meristems and early flower primordia, carpel and stamen filament epidermis, stigma papillae, ovule primordia, nucellus and embryo. {ECO:0000269\|PubMed:16778018}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that acts as negative regulator of trichome branching in association with HDG11 (PubMed:16778018). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). Acts as positive regulator of SCL18/LAS expression (PubMed:25358340). {ECO:0000269\|PubMed:16778018, ECO:0000269\|PubMed:25358340, ECO:0000269\|PubMed:25564655}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013587672.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013587672.1	4e-60	PREDICTED: homeobox-leucine zipper protein HDG12-like
Swissprot	Q9LMT8	2e-33	HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBL	A0A078H4N3	2e-51	A0A078H4N3_BRANA; BnaC01g36780D protein
TrEMBL	A0A0D3ADM9	2e-51	A0A0D3ADM9_BRAOL; Uncharacterized protein
STRING	Bo1g131210.1	3e-52	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17003	6	11

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17920.1	7e-36	homeodomain GLABROUS 12

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Tian C, et al. An organ boundary-enriched gene regulatory network uncovers regulatory hierarchies underlying axillary meristem initiation. Mol. Syst. Biol., 2014. 10: p. 755 [PMID:25358340] Horstman A, et al. AIL and HDG proteins act antagonistically to control cell proliferation. Development, 2015. 142(3): p. 454-64 [PMID:25564655]