![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013601550.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 180aa MW: 19707.5 Da PI: 10.572 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58 | 1.3e-18 | 40 | 74 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ Cgt kTplWR gp g+k+LCnaCG++ rkk++
XP_013601550.1 40 CVDCGTNKTPLWRGGPAGPKSLCNACGIKSRKKRQ 74
*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.2E-10 | 34 | 89 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.031 | 34 | 70 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 3.94E-12 | 35 | 78 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.3E-14 | 38 | 74 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 2.81E-11 | 39 | 73 | No hit | No description |
| Pfam | PF00320 | 2.3E-16 | 40 | 74 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 40 | 65 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 180 aa Download sequence Send to blast |
MSMTEETKTT TKLETAGDSS DVESGNCSSS GSGGDTKKTC VDCGTNKTPL WRGGPAGPKS 60 LCNACGIKSR KKRQAALGIR QEDNNNKIKN KTNNSLPLDH QTIKNRKGES GNVKNKIKTT 120 ESENFISRVN KKSLERASRF LDLGFKVPAM KRSVVEKKRL WRKLGEEERA AVLLMTLSCG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013601550.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK119021 | 6e-43 | AK119021.1 Arabidopsis thaliana At4g16141 mRNA for unknown protein, complete cds, clone: RAFL21-34-K14. | |||
| GenBank | AK228025 | 6e-43 | AK228025.1 Arabidopsis thaliana mRNA for hypothetical protein, partial sequence., clone: RAFL14-54-B16. | |||
| GenBank | AL161543 | 6e-43 | AL161543.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 43. | |||
| GenBank | CP002687 | 6e-43 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. | |||
| GenBank | Z97340 | 6e-43 | Z97340.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 5. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013601550.1 | 1e-128 | PREDICTED: GATA transcription factor 17-like | ||||
| Refseq | XP_013680437.1 | 1e-128 | GATA transcription factor 17-like | ||||
| Refseq | XP_013699138.1 | 1e-128 | GATA transcription factor 17-like | ||||
| Swissprot | Q9LIB5 | 5e-59 | GAT17_ARATH; GATA transcription factor 17 | ||||
| TrEMBL | A0A0D3A7R4 | 1e-127 | A0A0D3A7R4_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3N6UEQ3 | 1e-127 | A0A3N6UEQ3_BRACR; Uncharacterized protein | ||||
| STRING | Bo1g055120.1 | 1e-128 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13816 | 16 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G16141.1 | 2e-60 | GATA family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




