![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013608170.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 126aa MW: 14244 Da PI: 11.1883 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 79.2 | 4.8e-25 | 37 | 90 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+pr Wtp+LH+rF++a e+ G+++AtPk+i e+m+v+gLt+ v+SHLQkYR
XP_013608170.1 37 RPRNIWTPQLHQRFLDAFEHH-GINHATPKRITEFMNVDGLTRGSVASHLQKYRY 90
5899*****************.9*******************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.405 | 32 | 93 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.13E-20 | 34 | 94 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-25 | 36 | 95 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.7E-22 | 38 | 90 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 6.7E-8 | 41 | 89 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MPSQLQLPSS QANSSAEFAE NSADRGSGDE PARTLRRPRN IWTPQLHQRF LDAFEHHGIN 60 HATPKRITEF MNVDGLTRGS VASHLQKYRY QLKRIERREP FASFLVGKIK PSPSPSPSPS 120 PLQSRL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5lxu_A | 7e-22 | 37 | 93 | 1 | 57 | Transcription factor LUX |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013608170.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189431 | 9e-97 | AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013608170.1 | 3e-88 | PREDICTED: transcription factor LUX-like | ||||
| Swissprot | O22210 | 3e-26 | MYBC1_ARATH; Transcription factor MYBC1 | ||||
| TrEMBL | A0A0D3EB03 | 4e-86 | A0A0D3EB03_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A3P6E9S6 | 4e-86 | A0A3P6E9S6_BRAOL; Uncharacterized protein | ||||
| STRING | Bo9g117350.1 | 6e-87 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM15903 | 7 | 12 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G10760.1 | 2e-31 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




