PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_013609232.1

Organism

Brassica oleracea

Taxonomic ID

3712

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 283aa MW: 32596 Da PI: 9.3398

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013609232.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	179.8	7.3e-56	20	146	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL++kv ++ +++ +i evd++kvePwd+p k+k eekewyfF+ rd+ky+tg r+nratk+gyWkatgkdke+++ XP_013609232.1 20 LPPGFRFHPTDEELISYYLRPKVLNTFFSA-IAIGEVDLNKVEPWDIPWKAKIEEKEWYFFCLRDRKYPTGLRTNRATKAGYWKATGKDKEIFK- 112 79***********************999.88***********888999************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 +++lvg+kktLvfykgrapkg+kt+Wvmheyrle XP_013609232.1 113 EKSLVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 146 999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.81E-62	17	170	IPR003441	NAC domain
PROSITE profile	PS51005	57.748	20	170	IPR003441	NAC domain
Pfam	PF02365	3.6E-30	21	145	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009611	Biological Process	response to wounding
GO:0042542	Biological Process	response to hydrogen peroxide
GO:0051091	Biological Process	positive regulation of sequence-specific DNA binding transcription factor activity
GO:1900057	Biological Process	positive regulation of leaf senescence
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 283 aa Download sequence Send to blast
MDSEVSRTGE ITKDSEQTDL PPGFRFHPTD EELISYYLRP KVLNTFFSAI AIGEVDLNKV 60 EPWDIPWKAK IEEKEWYFFC LRDRKYPTGL RTNRATKAGY WKATGKDKEI FKEKSLVGMK 120 KTLVFYKGRA PKGVKTNWVM HEYRLEGKYA IDNNHKTAKN EWVISRIFQK QADGKKMHIS 180 SLMKLGSGIN QFEPVGLPPL MDSSPYLKSG GGDTFAWSLS HVPCFSDQTT EDKSHLSESR 240 DECNFTMFGS SSTHLSPGFQ YIGERINREF LARSRYFWFS SSG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-53	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-53	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-53	17	176	14	171	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-53	17	176	14	171	NO APICAL MERISTEM PROTEIN
3swm_A	2e-53	17	176	17	174	NAC domain-containing protein 19
3swm_B	2e-53	17	176	17	174	NAC domain-containing protein 19
3swm_C	2e-53	17	176	17	174	NAC domain-containing protein 19
3swm_D	2e-53	17	176	17	174	NAC domain-containing protein 19
3swp_A	2e-53	17	176	17	174	NAC domain-containing protein 19
3swp_B	2e-53	17	176	17	174	NAC domain-containing protein 19
3swp_C	2e-53	17	176	17	174	NAC domain-containing protein 19
3swp_D	2e-53	17	176	17	174	NAC domain-containing protein 19
4dul_A	1e-53	17	176	14	171	NAC domain-containing protein 19
4dul_B	1e-53	17	176	14	171	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269\|PubMed:21303842}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269\|PubMed:16581911, ECO:0000269\|PubMed:21303842}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:21303842}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013609232.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269\|PubMed:21303842}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF738272	0.0	KF738272.1 Brassica napus NAC transcription factor 59 (NAC59.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013609232.1	0.0	PREDICTED: NAC domain-containing protein 59-like isoform X2
Swissprot	Q9LJW3	1e-130	NAC59_ARATH; NAC domain-containing protein 59
TrEMBL	A0A0D3E0M2	0.0	A0A0D3E0M2_BRAOL; Uncharacterized protein
TrEMBL	A0A3P6E633	0.0	A0A3P6E633_BRAOL; Uncharacterized protein
STRING	Bo9g008770.1	0.0	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G29035.1	1e-132	NAC domain containing protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]