PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_013611132.1

Organism

Brassica oleracea

Taxonomic ID

3712

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NF-YB

Protein Properties

Length: 187aa MW: 20177.1 Da PI: 6.5136

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013611132.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	185.7	3.4e-58	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege XP_013611132.1 26 REQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGE 120 89********************************************************************************************9 PP NF-YB 97 k 97 + XP_013611132.1 121 R 121 7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.8E-54	20	129	IPR009072	Histone-fold
SuperFamily	SSF47113	2.33E-41	28	137	IPR009072	Histone-fold
Pfam	PF00808	1.1E-28	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	7.1E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	7.1E-21	78	96	No hit	No description
PRINTS	PR00615	7.1E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 187 aa Download sequence Send to blast
MGDSDRDSGG GQTGNNQNGQ SSLSPREQDR FLPIANVSRI MKKALPANAK ISKDAKETMQ 60 ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKVY LQRFREIEGE 120 RTGLGRPQTG GEAGEHQRDG GVGDGGGGYY GGGMGMQYQQ HHQFLHQQNH MYGSTGGGGG 180 GHSGGRS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	8e-49	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	8e-49	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072, ECO:0000269\|PubMed:9662544}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013611132.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC787661	0.0	KC787661.1 Brassica napus transcription factor subunit NF-YB2B (NF-YB2B) gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013611132.1	1e-136	PREDICTED: nuclear transcription factor Y subunit B-2
Refseq	XP_022565855.1	1e-136	nuclear transcription factor Y subunit B-2
Swissprot	Q9FGJ3	2e-87	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A3P6DUM0	1e-135	A0A3P6DUM0_BRAOL; Uncharacterized protein
TrEMBL	W6DGI7	1e-135	W6DGI7_BRANA; BnaC09g20320D protein
STRING	Bra017473.1-P	6e-98	(Brassica rapa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	2e-86	nuclear factor Y, subunit B2

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]