![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013614242.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10424.8 Da PI: 4.2897 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 33.5 | 9.6e-11 | 38 | 80 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
WT+eE ++l ++++++ + ++ Ia ++++ Rtl+++k+r+++
XP_013614242.1 38 VWTKEETDQLFELCERFDLR-FTVIADRFPLSRTLEELKDRYYS 80
6*******************.*********************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF16282 | 1.6E-26 | 17 | 82 | IPR032563 | DAMP1, SANT/Myb-like domain |
| SuperFamily | SSF46689 | 4.76E-8 | 35 | 81 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.6E-8 | 35 | 84 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.5E-8 | 38 | 81 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MICSSSIGLE WLMMFHHQSV DVLKYTDDEY ENHLTDPVWT KEETDQLFEL CERFDLRFTV 60 IADRFPLSRT LEELKDRYYS VTPGPAAC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3hm5_A | 6e-15 | 8 | 81 | 2 | 79 | DNA methyltransferase 1-associated protein 1 |
| 4iej_A | 6e-15 | 8 | 81 | 2 | 79 | DNA methyltransferase 1-associated protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013614242.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK353019 | 5e-85 | AK353019.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-19-J15. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013614238.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X2 | ||||
| Refseq | XP_013614239.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X2 | ||||
| Refseq | XP_013614240.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X2 | ||||
| Refseq | XP_013614241.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X3 | ||||
| Refseq | XP_013614242.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X3 | ||||
| Refseq | XP_013614243.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X3 | ||||
| Refseq | XP_013614244.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X4 | ||||
| Refseq | XP_013614245.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X4 | ||||
| Refseq | XP_013614247.1 | 5e-61 | PREDICTED: SWR1-complex protein 4-like isoform X4 | ||||
| Swissprot | Q8VZL6 | 3e-33 | SWC4_ARATH; SWR1-complex protein 4 | ||||
| TrEMBL | A0A3P6CJN7 | 2e-44 | A0A3P6CJN7_BRAOL; Uncharacterized protein | ||||
| STRING | Bra004471.1-P | 6e-38 | (Brassica rapa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47210.1 | 1e-35 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




