![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013615512.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 168aa MW: 18698.6 Da PI: 6.2315 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.4 | 5.8e-17 | 28 | 70 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
++T+eE+++l+ +++ +G++ W++I+r ++ gRt++ +k++w+
XP_013615512.1 28 TAFTEEEELRLLAVHRAYGNK-WALISRLFP-GRTDNAVKNHWHV 70
68*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.42E-22 | 9 | 77 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-9 | 9 | 33 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.851 | 22 | 76 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.6E-14 | 26 | 74 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.6E-14 | 27 | 69 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 7.96E-12 | 29 | 69 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-16 | 34 | 72 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
VINVASLTSG KSCRLRWFNQ LDPRINKTAF TEEEELRLLA VHRAYGNKWA LISRLFPGRT 60 DNAVKNHWHV IMARRTRESQ RQRHQPPQAP SGNAEMAVSS SYNHGDEFFG TVVNGTFVNE 120 EDDDADDGDA SAVSTCTTEL SLTPPSSAHQ LGFFNYDNTL ASGNNLCN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-21 | 10 | 76 | 62 | 128 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in developing seeds. {ECO:0000269|PubMed:23911125}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in flowers (at protein level) and siliques, and, to a lower extent, in roots, stems and leaves (PubMed:25343985). Expressed in embryos (e.g. heart and torpedo stages) and cotyledons, and, at low levels, in roots and inflorescence (PubMed:23911125). Accumulates specifically in root apical meristem quiescent center (QC) and vascular initial cells (PubMed:16581911, PubMed:24981610). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:23911125, ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as a cell-specific local repressor of quiescent center (QC) self-renewal by cell divisions in the primary root. Counteracts brassinosteroid (BR)-mediated cell division in the QC cells (PubMed:24981610). Regulates maternally seed size, especially before the heart stage, promoting both endothelial cells expansion and cell number in the outer integument layer of the seed coat (PubMed:23911125). Modulates the expression of genes involved in cell wall metabolism such as cell division and expansion (PubMed:23911125, PubMed:24981610). Negative regulator of flowering via the repression of FT transcription (PubMed:25343985). {ECO:0000269|PubMed:23911125, ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013615512.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Levels follow a circadian cycle with a progressive decrease during the day time (at protein level) (PubMed:25343985). Down-regulated by brassinosteroids (BRs) in a dose- and time-dependent manner. Repressed by BES1. Auto-activation of expression (PubMed:24981610). Targeted to 26S proteasomal degradation by the CULLIN3 (CUL3)-based E3 ligases CRL3(BPMs) (PubMed:25343985). {ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189450 | 0.0 | AC189450.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB071M18, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013615512.1 | 1e-124 | PREDICTED: transcription factor MYB59-like, partial | ||||
| Swissprot | Q6R053 | 3e-73 | MYB56_ARATH; Transcription factor MYB56 | ||||
| TrEMBL | A0A3P6DPF4 | 1e-121 | A0A3P6DPF4_BRAOL; Uncharacterized protein | ||||
| STRING | Bo03161s010.1 | 1e-112 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM9977 | 18 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G17800.1 | 1e-73 | myb domain protein 56 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




