![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013615783.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 129aa MW: 14938.2 Da PI: 9.6344 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 79.9 | 3e-25 | 66 | 114 | 3 | 51 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
r++W+++LH+r v+a++++GGs++AtPk+i+++mkv+gLt+++vkSHLQ
XP_013615783.1 66 RRKWSENLHRRIVDALQKIGGSQVATPKQIRDIMKVDGLTNDEVKSHLQ 114
99*********************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-20 | 62 | 114 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.51E-10 | 62 | 115 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 5.5E-21 | 66 | 115 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
THEEENMCVT QTCNNNNANQ REAIMSFNRP PPPPLSAPLS LQKSEILTDY SSRIEQSHPI 60 QKKELRRKWS ENLHRRIVDA LQKIGGSQVA TPKQIRDIMK VDGLTNDEVK SHLQVKVLIF 120 FFLYKLEKL |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, inflorescence apex, floral primordia, stamen primordia, carpel primordia and ovules. {ECO:0000269|PubMed:26903506}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower. Binds specifically to the DNA sequence motif 5'-GTAGATTCCT-3' of WUS promoter, and may be involved in direct regulation of WUS expression. Binds specifically to the DNA sequence motif 5'-AAGAATCTTT-3' found in the promoters of AG and the NAC domain genes CUC1, CUC2 and CUC3, and may be involved in direct regulation of these gene expressions. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013615783.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013615783.1 | 1e-92 | PREDICTED: protein PHR1-LIKE 1-like, partial | ||||
| Swissprot | F4JRB0 | 4e-33 | HHO5_ARATH; Transcription factor HHO5 | ||||
| TrEMBL | A0A0D2ZYM5 | 1e-74 | A0A0D2ZYM5_BRAOL; Uncharacterized protein | ||||
| STRING | Bo09513s010.1 | 2e-75 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4922 | 26 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37180.1 | 1e-34 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




