![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013619231.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 211aa MW: 23917.8 Da PI: 8.458 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 81.8 | 4.5e-26 | 9 | 56 | 1 | 48 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs++gkl+e
XP_013619231.1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFE 56
79********************************************98 PP
| |||||||
| 2 | K-box | 60.1 | 9.2e-21 | 99 | 181 | 18 | 100 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
+ e++ Lk+eie+Lq+ +R + G + + ++l+eL Le++Le +++iRs K+e++l++i+ l++ke l+++nk L +k+ee
XP_013619231.1 99 KDEVNVLKREIEMLQKGIRYMFGGGDGAMNLEELLLLEKHLEFWISQIRSAKMEIMLQEIQSLRNKEGVLKNANKFLLEKIEE 181
6899****************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 5.8E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.44E-28 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.576 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.67E-39 | 2 | 78 | No hit | No description |
| PRINTS | PR00404 | 2.8E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.7E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.8E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 12.69 | 95 | 185 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 5.6E-20 | 99 | 179 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 211 aa Download sequence Send to blast |
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEIGVVIFSP QGKLFELAAK 60 GTMDGIIDKY MKCTGGGRGS SSAIFTAQEQ LQPPNLEPKD EVNVLKREIE MLQKGIRYMF 120 GGGDGAMNLE ELLLLEKHLE FWISQIRSAK MEIMLQEIQS LRNKEGVLKN ANKFLLEKIE 180 ENNNSILDAN FTTVDTNYSY PLTMPSEIFQ F |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_B | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_C | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_D | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
| 6byy_A | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 3e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 2e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 2e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 2e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 2e-17 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
| Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_013619231.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC984302 | 0.0 | KC984302.2 Brassica oleracea var. viridis AGL12 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013619231.1 | 1e-155 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
| Refseq | XP_013640145.1 | 1e-155 | agamous-like MADS-box protein AGL12 | ||||
| Swissprot | Q38841 | 1e-136 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A078HJA0 | 1e-154 | A0A078HJA0_BRANA; BnaC02g20640D protein | ||||
| TrEMBL | A0A3P6DQC2 | 1e-154 | A0A3P6DQC2_BRAOL; Uncharacterized protein | ||||
| STRING | Bra007972.1-P | 1e-152 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7052 | 26 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 1e-138 | AGAMOUS-like 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




