PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

XP_013890670.1

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium

Family

Protein Properties

Length: 85aa MW: 8074.04 Da PI: 11.068

Description

GATA family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013890670.1	genome	BU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GATA	47.9	1.8e-15	2	34	3	35
GATA 3 nCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 +Cg+ ++p+WR+gp+ ++ +CnaCG +yr++++ XP_013890670.1 2 HCGVQESPQWRKGPQSKPVVCNACGTRYRRTNS 34 9***********99999********9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50114	9.539	1	37	IPR000679	Zinc finger, GATA-type
Gene3D	G3DSA:3.30.50.10	1.7E-11	2	35	IPR013088	Zinc finger, NHR/GATA-type
Pfam	PF00320	4.0E-13	2	33	IPR000679	Zinc finger, GATA-type
SuperFamily	SSF57716	5.7E-10	2	37	No hit	No description
SMART	SM00401	6.7E-5	2	45	IPR000679	Zinc finger, GATA-type
CDD	cd00202	3.23E-8	2	38	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008270	Molecular Function	zinc ion binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MHCGVQESPQ WRKGPQSKPV VCNACGTRYR RTNSLGPAIP STARPAAGGG GDGGSAPGGG 60 AKRKAASPPG GSGGGGSKGA AKAAC

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013890670.1	2e-51	hypothetical protein MNEG_16315
TrEMBL	A0A0D2M8A0	4e-50	A0A0D2M8A0_9CHLO; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP450	15	26

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47140.1	2e-11	GATA transcription factor 27

Link Out ? help Back to Top
Entrez Gene	25734062

Publications ? help Back to Top
Bogen C, et al. Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production. BMC Genomics, 2013. 14: p. 926 [PMID:24373495]