PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013891688.1
Organism
Monoraphidium neglectum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB_related
Protein Properties Length: 89aa    MW: 10228.3 Da    PI: 7.6139
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013891688.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.25.3e-203075247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       W++eEd +l+++v+++G  +W+ Ia++mg+gR +k+c++rw++ 
   XP_013891688.1 30 ATWSPEEDSRLLELVHRYGAQNWTVIASHMGNGRNGKSCRLRWFNQ 75
                     58*****************************************996 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6962480IPR017930Myb domain
SuperFamilySSF466891.86E-192589IPR009057Homeodomain-like
SMARTSM007177.2E-162878IPR001005SANT/Myb domain
PfamPF002498.6E-193076IPR001005SANT/Myb domain
CDDcd001671.40E-133174No hitNo description
Gene3DG3DSA:1.10.10.601.4E-233189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MRGAYRGDDS DSKSSGTDER HMGSAMLKRA TWSPEEDSRL LELVHRYGAQ NWTVIASHMG  60
NGRNGKSCRL RWFNQLDPRV NKEPFTEDE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-172689163C-Myb DNA-Binding Domain
1msf_C5e-172689163C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtActs as a cell-specific local repressor of quiescent center (QC) self-renewal by cell divisions in the primary root. Counteracts brassinosteroid (BR)-mediated cell division in the QC cells (PubMed:24981610). Regulates maternally seed size, especially before the heart stage, promoting both endothelial cells expansion and cell number in the outer integument layer of the seed coat (PubMed:23911125). Modulates the expression of genes involved in cell wall metabolism such as cell division and expansion (PubMed:23911125, PubMed:24981610). Negative regulator of flowering via the repression of FT transcription (PubMed:25343985). {ECO:0000269|PubMed:23911125, ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Levels follow a circadian cycle with a progressive decrease during the day time (at protein level) (PubMed:25343985). Down-regulated by brassinosteroids (BRs) in a dose- and time-dependent manner. Repressed by BES1. Auto-activation of expression (PubMed:24981610). Targeted to 26S proteasomal degradation by the CULLIN3 (CUL3)-based E3 ligases CRL3(BPMs) (PubMed:25343985). {ECO:0000269|PubMed:24981610, ECO:0000269|PubMed:25343985}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013891688.18e-62Transcription factor MYB44, partial
SwissprotQ6R0532e-21MYB56_ARATH; Transcription factor MYB56
TrEMBLA0A0D2K9G92e-60A0A0D2K9G9_9CHLO; Transcription factor MYB44 (Fragment)
STRINGGorai.013G196500.16e-22(Gossypium raimondii)
STRINGPP1S74_264V6.11e-21(Physcomitrella patens)
STRINGPP1S91_13V6.12e-21(Physcomitrella patens)
STRINGfgenesh2_kg.6__1780__AT5G17800.19e-22(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.12e-23myb domain protein 56
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]
  2. Chen L,Bernhardt A,Lee J,Hellmann H
    Identification of Arabidopsis MYB56 as a novel substrate for CRL3BPM E3 ligases.
    Mol Plant, 2015.
    [PMID:25343985]
  3. Frigola D,Caño-Delgado AI,Ibañes M
    Methods for Modeling Brassinosteroid-Mediated Signaling in Plant Development.
    Methods Mol. Biol., 2017. 1564: p. 103-120
    [PMID:28124249]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Jeong CY, et al.
    AtMyb56 Regulates Anthocyanin Levels via the Modulation of AtGPT2 Expression in Response to Sucrose in Arabidopsis.
    Mol. Cells, 2018. 41(4): p. 351-361
    [PMID:29487277]