PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

XP_013892193.1

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium

Family

Protein Properties

Length: 113aa MW: 13294.6 Da PI: 10.1604

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013892193.1	genome	BU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.9	5.6e-14	9	53	3	48
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 W Ede+l+ av ++G ++W++I++ + ++++kqck rw+ +l XP_013892193.1 9 IWKNTEDEILKAAVMKYGLNQWARISSLLV-RKSAKQCKARWYEWL 53 5999************************.**********986 PP
2	Myb_DNA-binding	38.8	2.1e-12	60	103	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k+l++ W+tIa +g Rt+ qc +r+ k+l XP_013892193.1 60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPAQCLERYEKLL 103 68***************99.****8..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.426	2	53	IPR017930	Myb domain
SMART	SM00717	7.6E-14	6	55	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-19	9	61	IPR009057	Homeodomain-like
CDD	cd00167	5.01E-11	10	53	No hit	No description
Pfam	PF13921	4.4E-14	10	70	No hit	No description
SuperFamily	SSF46689	3.24E-22	33	109	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.517	54	107	IPR017930	Myb domain
CDD	cd11659	1.08E-30	55	107	No hit	No description
SMART	SM00717	1.2E-12	58	105	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-14	62	104	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009870	Biological Process	defense response signaling pathway, resistance gene-dependent
GO:0010204	Biological Process	defense response signaling pathway, resistance gene-independent
GO:0042742	Biological Process	defense response to bacterium
GO:0050832	Biological Process	defense response to fungus
GO:0009507	Cellular Component	chloroplast
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MRIQIKGGIW KNTEDEILKA AVMKYGLNQW ARISSLLVRK SAKQCKARWY EWLDPAIKKT 60 EWTREEDEKL LHLAKLLPTQ WRTIAPIVGR TPAQCLERYE KLLDMAVGKD DRN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
5xjc_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
5yzg_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
5z56_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
5z57_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
5z58_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6ff4_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6ff7_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6icz_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6id0_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6id1_L	2e-59	2	111	3	112	Cell division cycle 5-like protein
6qdv_O	2e-59	2	111	3	112	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00028	SELEX	Transfer from AT1G09770	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF458962	2e-54	AF458962.1 Zea mays CDC5 protein (CDC5) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013892193.1	7e-78	pre-mRNA-splicing factor CDC5/CEF1
Swissprot	P92948	4e-67	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A0D2KB48	2e-76	A0A0D2KB48_9CHLO; Pre-mRNA-splicing factor CDC5/CEF1
TrEMBL	A0A2V0PB65	2e-72	A0A2V0PB65_9CHLO; Uncharacterized protein
STRING	XP_005851759.1	2e-70	(Chlorella variabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP1040	16	17

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	2e-69	cell division cycle 5

Link Out ? help Back to Top
Entrez Gene	25732387

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Bogen C, et al. Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production. BMC Genomics, 2013. 14: p. 926 [PMID:24373495] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]