![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_013892784.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
||||||||
| Family | CPP | ||||||||
| Protein Properties | Length: 78aa MW: 8820.43 Da PI: 9.0577 | ||||||||
| Description | CPP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCR | 46.1 | 9.9e-15 | 13 | 50 | 3 | 41 |
TCR 3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
k+C Ckk +Clk+YC Cfaag +C+ C+C++C+N+e+
XP_013892784.1 13 AKRCACKKARCLKLYCVCFAAGMFCDG-CSCDKCQNTEK 50
799************************.********987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01114 | 3.4E-13 | 11 | 51 | IPR033467 | Tesmin/TSO1-like CXC domain |
| PROSITE profile | PS51634 | 15.972 | 12 | 78 | IPR005172 | CRC domain |
| Pfam | PF03638 | 9.5E-12 | 14 | 49 | IPR005172 | CRC domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MPLQAFMQGP QAAKRCACKK ARCLKLYCVC FAAGMFCDGC SCDKCQNTEK DQSIVMQQRG 60 RVLARNPQSF LPKERRPE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013892784.1 | 9e-51 | hypothetical protein MNEG_14200 | ||||
| Swissprot | Q9SL70 | 6e-15 | TCX6_ARATH; Protein tesmin/TSO1-like CXC 6 | ||||
| TrEMBL | A0A0D2LPU6 | 2e-49 | A0A0D2LPU6_9CHLO; Uncharacterized protein | ||||
| STRING | XP_009346088.1 | 2e-16 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP323 | 15 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G20110.2 | 5e-08 | Tesmin/TSO1-like CXC domain-containing protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 25731739 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




