| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HSF_DNA-bind | 75.5 | 9.7e-24 | 18 | 77 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
Fl k+y++++d++++e++sws+ ++sfvv+++ efa+ +Lp++Fkh+nf+SF+RQLn+Y
XP_015868935.1 18 FLLKTYDMVDDSSTDEIVSWSSVKTSFVVWNPPEFARLLLPTFFKHNNFSSFIRQLNTYT 77
9**********************************************************5 PP
|
| Publications
? help Back to Top |
- McClung CR, et al.
Integrated temporal regulation of the photorespiratory pathway. Circadian regulation of two Arabidopsis genes encoding serine hydroxymethyltransferase.
Plant Physiol., 2000. 123(1): p. 381-92
[PMID:10806255] - Bauwe H,Kolukisaoglu U
Genetic manipulation of glycine decarboxylation.
J. Exp. Bot., 2003. 54(387): p. 1523-35
[PMID:12730263] - Wienkoop S, et al.
Cell-specific protein profiling in Arabidopsis thaliana trichomes: identification of trichome-located proteins involved in sulfur metabolism and detoxification.
Phytochemistry, 2004. 65(11): p. 1641-9
[PMID:15276459] - Nikiforova VJ,Daub CO,Hesse H,Willmitzer L,Hoefgen R
Integrative gene-metabolite network with implemented causality deciphers informational fluxes of sulphur stress response.
J. Exp. Bot., 2005. 56(417): p. 1887-96
[PMID:15911562] - Noir S,Bräutigam A,Colby T,Schmidt J,Panstruga R
A reference map of the Arabidopsis thaliana mature pollen proteome.
Biochem. Biophys. Res. Commun., 2005. 337(4): p. 1257-66
[PMID:16242667] - Holmes-Davis R,Tanaka CK,Vensel WH,Hurkman WJ,McCormick S
Proteome mapping of mature pollen of Arabidopsis thaliana.
Proteomics, 2005. 5(18): p. 4864-84
[PMID:16247729] - Sivanandan C, et al.
T-DNA tagging and characterization of a cryptic root-specific promoter in Arabidopsis.
Biochim. Biophys. Acta, 2005. 1731(3): p. 202-8
[PMID:16307804] - Rajjou L, et al.
Proteomic investigation of the effect of salicylic acid on Arabidopsis seed germination and establishment of early defense mechanisms.
Plant Physiol., 2006. 141(3): p. 910-23
[PMID:16679420] - Mull L,Ebbs ML,Bender J
A histone methylation-dependent DNA methylation pathway is uniquely impaired by deficiency in Arabidopsis S-adenosylhomocysteine hydrolase.
Genetics, 2006. 174(3): p. 1161-71
[PMID:16951055] - Ichikawa T, et al.
The FOX hunting system: an alternative gain-of-function gene hunting technique.
Plant J., 2006. 48(6): p. 974-85
[PMID:17227551] - Marmagne A, et al.
A high content in lipid-modified peripheral proteins and integral receptor kinases features in the arabidopsis plasma membrane proteome.
Mol. Cell Proteomics, 2007. 6(11): p. 1980-96
[PMID:17644812] - Hajduch M, et al.
Systems analysis of seed filling in Arabidopsis: using general linear modeling to assess concordance of transcript and protein expression.
Plant Physiol., 2010. 152(4): p. 2078-87
[PMID:20118269] - Zhang Y,Sun K,Sandoval FJ,Santiago K,Roje S
One-carbon metabolism in plants: characterization of a plastid serine hydroxymethyltransferase.
Biochem. J., 2010. 430(1): p. 97-105
[PMID:20518745] - Lozano-Juste J,Colom-Moreno R,León J
In vivo protein tyrosine nitration in Arabidopsis thaliana.
J. Exp. Bot., 2011. 62(10): p. 3501-17
[PMID:21378116] - Zhou H, et al.
Ubiquitin-specific protease16 modulates salt tolerance in Arabidopsis by regulating Na(+)/H(+) antiport activity and serine hydroxymethyltransferase stability.
Plant Cell, 2012. 24(12): p. 5106-22
[PMID:23232097] - Schenck CA, et al.
A proteomics approach identifies novel proteins involved in gravitropic signal transduction.
Am. J. Bot., 2013. 100(1): p. 194-202
[PMID:23281391] - Wei Z, et al.
Folate polyglutamylation eliminates dependence of activity on enzyme concentration in mitochondrial serine hydroxymethyltransferases from Arabidopsis thaliana.
Arch. Biochem. Biophys., 2013. 536(1): p. 87-96
[PMID:23800877]
|
