![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015872425.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 129aa MW: 13827.6 Da PI: 5.7778 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.4 | 7.5e-57 | 33 | 126 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+eplkvyl++yre+
XP_015872425.1 33 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREVI 126
69******************************************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-52 | 32 | 125 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.57E-39 | 36 | 125 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.9E-29 | 39 | 103 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.4E-21 | 67 | 85 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 70 | 86 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.4E-21 | 86 | 104 | No hit | No description |
| PRINTS | PR00615 | 1.4E-21 | 105 | 123 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MAEAAPTSPA GGSHESGGEQ SPHAGGGGGG GGVREQDRYL PIANISRIMK KALPANGKIA 60 KDAKDTVQEC VSEFISFITS EASDKCQKEK RKTINGDDLL WAMATLGFED YIEPLKVYLA 120 RYREVIVNL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 1e-48 | 32 | 124 | 1 | 93 | NF-YB |
| 4awl_B | 1e-48 | 32 | 124 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-48 | 32 | 124 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015872425.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015872425.1 | 3e-92 | nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_015872426.1 | 3e-92 | nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | Q8VYK4 | 1e-66 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A2P5B6J4 | 2e-77 | A0A2P5B6J4_PARAD; Nuclear transcription factor Y subunit B | ||||
| STRING | XP_006485940.1 | 5e-76 | (Citrus sinensis) | ||||
| STRING | XP_006436200.1 | 5e-76 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2545 | 33 | 82 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 5e-70 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




