![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015872679.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 124aa MW: 13407.3 Da PI: 6.78 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 114.3 | 9.1e-36 | 1 | 84 | 54 | 137 |
Whirly 54 sfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
+f+lsatev++l++l++ esceffhdp++ +sn+G+vrk+l+++P+ +GsG+f+ lsv n+l+k+++++ vPv+ aefav++++
XP_015872679.1 1 VFSLSATEVGSLISLGADESCEFFHDPSMLTSNAGQVRKSLSIKPHGNGSGYFIALSVVNNLLKSKDNLGVPVTTAEFAVMKTA 84
59********************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 5.34E-38 | 1 | 106 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 1.7E-42 | 1 | 104 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 1.7E-32 | 1 | 83 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005739 | Cellular Component | mitochondrion | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
VFSLSATEVG SLISLGADES CEFFHDPSML TSNAGQVRKS LSIKPHGNGS GYFIALSVVN 60 NLLKSKDNLG VPVTTAEFAV MKTACSFALP HIMGWDRLTN KMPRGTEGQT SMIDRQALSL 120 EWDK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3n1h_A | 2e-53 | 1 | 101 | 69 | 169 | StWhy2 |
| 3n1i_A | 2e-53 | 1 | 101 | 69 | 169 | protein StWhy2 |
| 3n1j_A | 2e-53 | 1 | 101 | 69 | 169 | Protein StWhy2 |
| 3n1k_A | 2e-53 | 1 | 101 | 69 | 169 | protein StWhy2 |
| 3n1l_A | 2e-53 | 1 | 101 | 69 | 169 | protein StWhy2 |
| 3r9y_A | 2e-53 | 1 | 101 | 69 | 169 | Why2 protein |
| 3r9z_A | 2e-53 | 1 | 101 | 69 | 169 | Why2 protein |
| 3ra0_A | 2e-53 | 1 | 101 | 69 | 169 | Why2 protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015872679.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015872679.1 | 1e-88 | single-stranded DNA-binding protein WHY2, mitochondrial, partial | ||||
| Swissprot | D9J034 | 4e-55 | WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A2I4FRC2 | 3e-64 | A0A2I4FRC2_JUGRE; single-stranded DNA-bindig protein WHY2, mitochondrial | ||||
| STRING | XP_010035836.1 | 1e-60 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11383 | 33 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 2e-52 | WHIRLY 2 | ||||




