![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015872707.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 120aa MW: 13330.2 Da PI: 8.2113 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 53.8 | 4.4e-17 | 6 | 35 | 26 | 55 |
G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
+AtPkti+++m+vkgLtl+h+kSHLQkYRl
XP_015872707.1 6 EATPKTIMRTMGVKGLTLYHLKSHLQKYRL 35
7****************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 1.2E-10 | 6 | 36 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-15 | 6 | 36 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.97E-6 | 6 | 38 | IPR009057 | Homeodomain-like |
| Pfam | PF14379 | 6.1E-12 | 83 | 106 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MICIAEATPK TIMRTMGVKG LTLYHLKSHL QKYRLGKQSC KDSTENSKDV GITASCIAES 60 QDTGSSSTSS SRMMAQELND GYQVTEALRV QMEVQRRLHE QLEVSRFCYL FCIAATTNAA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015872707.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015872707.1 | 2e-85 | protein PHR1-LIKE 3-like isoform X1 | ||||
| Swissprot | Q8LAJ7 | 9e-52 | PHL3_ARATH; Protein PHR1-LIKE 3 | ||||
| TrEMBL | A0A2N9G4L5 | 8e-57 | A0A2N9G4L5_FAGSY; Uncharacterized protein | ||||
| TrEMBL | M5Y4K3 | 4e-57 | M5Y4K3_PRUPE; Uncharacterized protein (Fragment) | ||||
| STRING | EMJ26760 | 7e-58 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF13367 | 21 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G13640.1 | 3e-50 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




