![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015872841.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 164aa MW: 18266.2 Da PI: 5.6576 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 91.4 | 9.7e-29 | 109 | 164 | 2 | 57 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--S CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDe 57
C v++C+adls+++eyh+rh+vCe hsk+p+v+v+g+e+rfCqqCsrfh+l efDe
XP_015872841.1 109 CLVDDCKADLSSCREYHKRHRVCERHSKTPTVMVKGEEKRFCQQCSRFHALGEFDE 164
*******************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 5.6E-29 | 102 | 164 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 23.282 | 106 | 164 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.81E-27 | 107 | 164 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 3.0E-22 | 109 | 164 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 164 aa Download sequence Send to blast |
NQGEQIEKVD GVMEWDLKEF AWESTHELDQ QKEESDLTAM VEFSTSKKQT TTTTVNGSSG 60 DLKLTVVDSA EPVSFSKSNE ARTTSILASS PTSPGPSSKK VNGAQKVSCL VDDCKADLSS 120 CREYHKRHRV CERHSKTPTV MVKGEEKRFC QQCSRFHALG EFDE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj0_A | 4e-20 | 107 | 163 | 4 | 60 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | SBP transcriptional regulator probably involved in the domestication of maize. Acts as a transcriptional repressor binding to a 5'-GTAC-3' motif. May repress the growth of lateral branches in length and numbers. {ECO:0000250|UniProtKB:Q49I55}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015872841.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015871790.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
| Refseq | XP_015871791.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
| Refseq | XP_015871794.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
| Refseq | XP_015871795.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
| Refseq | XP_015871799.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X2 | ||||
| Refseq | XP_015871800.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X3 | ||||
| Refseq | XP_015872096.1 | 1e-118 | squamosa promoter-binding-like protein 13A, partial | ||||
| Refseq | XP_015872841.1 | 1e-119 | teosinte glume architecture 1-like, partial | ||||
| Refseq | XP_015872885.1 | 1e-118 | squamosa promoter-binding protein 2-like, partial | ||||
| Refseq | XP_024925862.1 | 1e-116 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
| Refseq | XP_024925868.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
| Refseq | XP_024925870.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
| Refseq | XP_024925872.1 | 1e-117 | squamosa promoter-binding-like protein 13A isoform X4 | ||||
| Swissprot | Q49I57 | 2e-24 | TGA1B_MAIZE; Teosinte glume architecture 1 | ||||
| TrEMBL | A0A2P5CJQ3 | 3e-55 | A0A2P5CJQ3_PARAD; SBP-box transcription factor | ||||
| STRING | XP_010112387.1 | 5e-40 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10031 | 26 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G50670.1 | 3e-26 | SBP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




