PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_015881061.1

Organism

Ziziphus jujuba

Taxonomic ID

326968

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus

Family

M-type_MADS

Protein Properties

Length: 113aa MW: 13096 Da PI: 9.1126

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_015881061.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	76.3	2.3e-24	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n r++t+skRr gilKKA+ELSvLCda+v +++fs++g+l +ss XP_015881061.1 10 KIDNPCSRHTTYSKRRDGILKKASELSVLCDADVGLLMFSPSGRLTSFSS 59 599********************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	24.866	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.1E-30	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-25	2	75	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-19	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-19	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-19	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MGRQKRLMMK IDNPCSRHTT YSKRRDGILK KASELSVLCD ADVGLLMFSP SGRLTSFSSN 60 GRIEDVFLRY VDQPNELRGG PVSNEDYFYQ RLRELKHEGE MLEKLSKYDF LSP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_015881061.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015881061.2	2e-75	agamous-like MADS-box protein AGL104
Swissprot	Q6Z6W2	2e-24	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A2Z7A856	2e-49	A0A2Z7A856_9LAMI; AGAMOUS-like 66 isoform 1
STRING	EOX99189	5e-47	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17539	6	7

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77980.1	1e-26	AGAMOUS-like 66

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]