![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015883523.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 91aa MW: 10302.7 Da PI: 5.8801 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 23.6 | 9.5e-08 | 20 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+iN+ +L++llP + + +s+ + ++iLe+++ YIk L
XP_015883523.1 20 DEINELVLKLQTLLPLL-RHNSTVAEASTILEETCSYIKRL 59
68**************5.467777***************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.991 | 6 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 4.8E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 8.9E-9 | 20 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 2.2E-9 | 20 | 80 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MSSRRSSSSS RSAASKPTDD EINELVLKLQ TLLPLLRHNS TVAEASTILE ETCSYIKRLR 60 REVDNLSERL SQLMDTADIT QVEVIRKLLQ D |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015883523.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015883523.1 | 1e-57 | transcription factor PRE3 | ||||
| Swissprot | F4JCN9 | 1e-21 | PRE4_ARATH; Transcription factor PRE4 | ||||
| TrEMBL | W9R062 | 2e-24 | W9R062_9ROSA; Uncharacterized protein | ||||
| STRING | XP_010092048.1 | 3e-25 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10624 | 24 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G47710.1 | 5e-14 | BANQUO 3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




