![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015893167.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 128aa MW: 14962 Da PI: 6.9738 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 106.9 | 2.5e-33 | 21 | 123 | 3 | 107 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97
pGfrFhPt+eel+++yLk+ v g++l++ ++i ++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++s
XP_015893167.1 21 PGFRFHPTEEELLDFYLKNMVMGSRLRF-DIIGFLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKHGSGGRPNRTTEKGFWKATGSDRRIVS-LM 113
9*************************99.99***************888999**************************************99.44 PP
NAM 98 elvglkktLv 107
e + L+
XP_015893167.1 114 ESSLYHEDLI 123
4445555555 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.02E-37 | 19 | 114 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 34.882 | 19 | 128 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.8E-16 | 21 | 107 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MAAASSASNS MDEMTPELDL PGFRFHPTEE ELLDFYLKNM VMGSRLRFDI IGFLNIYRHD 60 PWDLPGMAKI GEREWYFFVP RDRKHGSGGR PNRTTEKGFW KATGSDRRIV SLMESSLYHE 120 DLIFVRIR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 2e-32 | 17 | 124 | 12 | 120 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015893167.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015893167.1 | 4e-91 | NAC domain-containing protein 22-like | ||||
| Swissprot | Q10S65 | 6e-56 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
| TrEMBL | A0A2I4GZ82 | 3e-64 | A0A2I4GZ82_JUGRE; NAC domain-containing protein 35-like | ||||
| STRING | XP_008382468.1 | 9e-64 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6214 | 32 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G17040.1 | 2e-59 | NAC domain containing protein 36 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




