![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015899561.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 67aa MW: 8025.48 Da PI: 9.9574 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 58.4 | 1.4e-18 | 9 | 46 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
sYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
XP_015899561.1 9 WSYYRCTHPTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 46
59***********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 1.2E-9 | 2 | 47 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.06E-14 | 9 | 47 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.4E-13 | 10 | 46 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.5E-15 | 10 | 46 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 15.101 | 10 | 48 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MKKFLFISWS YYRCTHPTCN VKKQVQRLSK DTSIVVTTYE GIHNHPCEKL METLTPLLKQ 60 MQFLSRF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015899561.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015899582.1 | 9e-36 | probable WRKY transcription factor 24 | ||||
| Swissprot | Q8VWQ4 | 3e-30 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| TrEMBL | A0A059C012 | 1e-33 | A0A059C012_EUCGR; Uncharacterized protein | ||||
| STRING | XP_008344897.1 | 9e-35 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3227 | 34 | 71 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64000.1 | 1e-32 | WRKY DNA-binding protein 56 | ||||




