![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_015899981.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 137aa MW: 15347.4 Da PI: 5.3879 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 160.5 | 2.5e-50 | 19 | 112 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvtseas kc++e+rkt+ngdd++wal+ lGf++++ pl+ yl +yre+e
XP_015899981.1 19 KEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTSEASVKCRKERRKTVNGDDVCWALGALGFDEFAGPLRRYLDRYREIED 112
89******************************************************************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-49 | 13 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.9E-38 | 21 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 8.4E-27 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.5E-15 | 52 | 70 | No hit | No description |
| PRINTS | PR00615 | 2.5E-15 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 2.5E-15 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 137 aa Download sequence Send to blast |
MEMEDNIGGE ASNSEGGIKE QDRLLPIANV GRIMKKILPP NAKISKEAKE TMQECVSEFI 60 SFVTSEASVK CRKERRKTVN GDDVCWALGA LGFDEFAGPL RRYLDRYREI EDRPNQEKVS 120 ANNSGSSARL NLPDRLL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-42 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-42 | 18 | 109 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_015899981.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015899981.1 | 5e-97 | nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 2e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2C9WB97 | 1e-68 | A0A2C9WB97_MANES; Uncharacterized protein | ||||
| TrEMBL | B9RT32 | 2e-68 | B9RT32_RICCO; Ccaat-binding transcription factor subunit A, putative | ||||
| STRING | cassava4.1_018746m | 2e-69 | (Manihot esculenta) | ||||
| STRING | XP_002516901.1 | 3e-69 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 8e-55 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




