PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016433116.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

TCP

Protein Properties

Length: 136aa MW: 15048.8 Da PI: 10.2173

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016433116.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	97.7	2.2e-30	67	130	2	65
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65 g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++ k +eWLl++ p+i el+++ XP_016433116.1 67 SGGKDRHSKVWTSKGLRDRRVRLSVNTAIQFYDLQDRLGYDQPNKDVEWLLKATAPSISELPSL 130 689*********************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	4.0E-30	68	130	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	30.06	69	127	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MEAWGKNLTN VTSLGETRTK KSCNGNGRFE SQDENETVKG SHGLGGGGVS RLCGWPSNRI 60 VRVSRASGGK DRHSKVWTSK GLRDRRVRLS VNTAIQFYDL QDRLGYDQPN KDVEWLLKAT 120 APSISELPSL NVFPDT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zkt_A	8e-24	74	128	1	55	Putative transcription factor PCF6
5zkt_B	8e-24	74	128	1	55	Putative transcription factor PCF6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179, ECO:0000269\|PubMed:26596765}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:26596765}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016433116.1	9e-97	PREDICTED: transcription factor TCP2-like
Swissprot	Q93V43	2e-37	TCP2_ARATH; Transcription factor TCP2
TrEMBL	A0A1S3X005	2e-95	A0A1S3X005_TOBAC; transcription factor TCP2-like
STRING	XP_009762097.1	5e-94	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2464	22	52

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18390.2	2e-39	TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2

Publications ? help Back to Top
Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375]