PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016437903.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

bZIP

Protein Properties

Length: 136aa MW: 16229.3 Da PI: 10.2177

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016437903.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	27.4	7.4e-09	5	53	15	63
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 A+rsR RK+++i+eLe+ v++L+ae ++ ele l+++ l +e+ XP_016437903.1 5 QFAQRSRVRKLQYIAELERNVQVLQAESSEVSAELEFLNQQNLILNMEN 53 559*************************************999888887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd14703	8.68E-12	1	46	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.8E-8	1	50	No hit	No description
PROSITE profile	PS50217	8.737	1	56	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.11E-7	2	49	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MKHRQFAQRS RVRKLQYIAE LERNVQVLQA ESSEVSAELE FLNQQNLILN MENKALKQRL 60 ENLAQEQLIK YLEHEVLERE RGRLRALYQQ QQQQQPQQLS SSHRRNTSRD LDQQFANLSL 120 RQKEANRDPV SGQLHI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269\|PubMed:17719007, ECO:0000269\|PubMed:19449183}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT013319	2e-47	BT013319.1 Lycopersicon esculentum clone 135006R, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016437903.1	2e-90	PREDICTED: basic leucine zipper 34-like
Swissprot	F4IN23	5e-23	BZP34_ARATH; Basic leucine zipper 34
TrEMBL	A0A1S3XDQ3	5e-89	A0A1S3XDQ3_TOBAC; basic leucine zipper 34-like
STRING	XP_009602803.1	9e-85	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2765	17	33

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58110.2	3e-51	bZIP family protein

Publications ? help Back to Top
Jiang J,Zhang Z,Cao J Pollen wall development: the associated enzymes and metabolic pathways. Plant Biol (Stuttg), 2013. 15(2): p. 249-63 [PMID:23252839] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]