![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016438472.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 74aa MW: 7847.75 Da PI: 5.8143 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 85 | 8.9e-27 | 27 | 74 | 2 | 49 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tse
XP_016438472.1 27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSE 74
89********************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.15E-16 | 21 | 74 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-24 | 23 | 74 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.0E-16 | 32 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MAEPASPGGG GGSHESGGER SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV 60 QECVSEFISF ITSE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-22 | 25 | 74 | 1 | 50 | NF-YB |
| 4awl_B | 2e-22 | 25 | 74 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-22 | 25 | 74 | 2 | 51 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 3e-22 | 26 | 74 | 1 | 49 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-22 | 26 | 74 | 1 | 49 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU457806 | 3e-70 | CU457806.5 S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence. | |||
| GenBank | HG975443 | 3e-70 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. | |||
| GenBank | HG975516 | 3e-70 | HG975516.1 Solanum lycopersicum chromosome ch04, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016438472.1 | 3e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Refseq | XP_016439627.1 | 4e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| Refseq | XP_016459816.1 | 3e-48 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Swissprot | Q8VYK4 | 4e-31 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A1S3XF20 | 6e-47 | A0A1S3XF20_TOBAC; nuclear transcription factor Y subunit B-10-like | ||||
| TrEMBL | A0A1S3XIX5 | 9e-47 | A0A1S3XIX5_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
| STRING | XP_009782060.1 | 3e-47 | (Nicotiana sylvestris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.6 | 2e-28 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




