PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016440040.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB_related

Protein Properties

Length: 89aa MW: 10211.8 Da PI: 10.2883

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016440040.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.7	1.8e-15	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W+++Ed++l++++ ++G +W++++ g+ R +k+c++rw +yl XP_016440040.1 15 KGLWSPDEDDKLKNYIIKHGHSCWSSVPINAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.6E-22	9	65	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.343	10	66	IPR017930	Myb domain
SMART	SM00717	4.2E-11	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	5.5E-14	15	62	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.03E-19	17	89	IPR009057	Homeodomain-like
CDD	cd00167	1.64E-9	18	62	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.1E-7	66	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGCKSVDKTK QKHKKGLWSP DEDDKLKNYI IKHGHSCWSS VPINAGLQRN GKSCRLRWIN 60 YLRPGLKRGA FSLDEEETIL TLHAMFGNK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269\|PubMed:11581165, ECO:0000269\|PubMed:19482971}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009629823.1	4e-60	PREDICTED: transcription factor LAF1-like
Refseq	XP_016440040.1	2e-61	PREDICTED: transcription factor LAF1-like
Swissprot	Q9M0K4	6e-39	LAF1_ARATH; Transcription factor LAF1
TrEMBL	A0A1S3XJ88	4e-60	A0A1S3XJ88_TOBAC; transcription factor LAF1-like
TrEMBL	A0A1S3XQZ6	6e-58	A0A1S3XQZ6_TOBAC; transcription factor LAF1-like
TrEMBL	A0A1U7VLR8	6e-58	A0A1U7VLR8_NICSY; transcription factor LAF1-like
STRING	XP_009629823.1	1e-59	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G25560.1	3e-41	myb domain protein 18

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]