![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016447154.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 165aa MW: 17994 Da PI: 5.079 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 178 | 8.9e-56 | 26 | 123 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vre+dr+lPian++rimkk+lP+naki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddl+wal+tlGfe+y+eplk+yl +yre+eg
XP_016447154.1 26 VREHDRYLPIANIGRIMKKALPTNAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLVWALTTLGFEEYIEPLKAYLIRYREMEG 120
589******************************************************************************************** PP
NF-YB 96 ekk 98
++k
XP_016447154.1 121 DTK 123
975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.0E-52 | 23 | 128 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.04E-39 | 30 | 131 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-19 | 60 | 78 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.7E-19 | 79 | 97 | No hit | No description |
| PRINTS | PR00615 | 1.7E-19 | 98 | 116 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MAEAPASPGG GGSHESGGER SPQSNVREHD RYLPIANIGR IMKKALPTNA KIAKEAKDTV 60 QECVSEFISF ITSEASDKCQ KEKRKTINGD DLVWALTTLG FEEYIEPLKA YLIRYREMEG 120 DTKGSARGGD GPAREDIVGG QLNSSTQFVY EGSFTHGLDY GNSQM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-46 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-46 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975443 | 4e-56 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009616488.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Refseq | XP_016447154.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Refseq | XP_018630666.1 | 1e-121 | PREDICTED: nuclear transcription factor Y subunit B-10-like | ||||
| Swissprot | Q8VYK4 | 4e-76 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A1S3Y4R4 | 1e-120 | A0A1S3Y4R4_TOBAC; nuclear transcription factor Y subunit B-10-like | ||||
| STRING | XP_009616488.1 | 1e-120 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-71 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




