![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016452159.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 151aa MW: 17154.4 Da PI: 5.0719 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.7 | 6.2e-57 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplk+yl+++r+leg+
XP_016452159.1 19 REQDRFLPIANVSRIMKKALPANAKISKDAKEIVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKIYLQRFRDLEGQ 113
89*******************************************************************************************98 PP
NF-YB 97 k 97
k
XP_016452159.1 114 K 114
6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.5E-54 | 13 | 118 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.33E-40 | 21 | 118 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.1E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.6E-21 | 52 | 70 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.6E-21 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 7.6E-21 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MADSDNESGG QRESESSLRE QDRFLPIANV SRIMKKALPA NAKISKDAKE IVQECVSEFI 60 SFITGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYIEPL KIYLQRFRDL EGQKSTMVGI 120 QDKENGGTVN MGSYVEDYGM IMMGQHHQRH V |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 1e-47 | 17 | 109 | 1 | 93 | NF-YB |
| 4awl_B | 1e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT013228 | 6e-95 | BT013228.1 Lycopersicon esculentum clone 134470F, mRNA sequence. | |||
| GenBank | HG975519 | 6e-95 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009602971.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Refseq | XP_016452159.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
| Swissprot | O23310 | 1e-71 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A1S3YIU6 | 1e-109 | A0A1S3YIU6_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
| STRING | XP_009602971.1 | 1e-110 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 6e-74 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




