PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016454006.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NAC

Protein Properties

Length: 167aa MW: 19416.4 Da PI: 10.4108

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016454006.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	173.6	6e-54	10	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 l+pGfrFhPtdeelv +yL++k+ gk+l++ ++i+e+diykvePwdLp +++k+++ ewyfFs dkk+ +g ++nrat++gyWk+tgkd++v+ XP_016454006.1 10 LAPGFRFHPTDEELVRYYLRRKIIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSMLDKKHGNGAKTNRATERGYWKTTGKDRAVH 103 579***********************99.99***********6347788888*********************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 + k+++vg+kktLv+++grapkg++t+Wvmhey+l XP_016454006.1 104 H-KSKVVGMKKTLVYHSGRAPKGQRTNWVMHEYKL 137 .999***************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.92E-58	8	144	IPR003441	NAC domain
PROSITE profile	PS51005	52.905	10	167	IPR003441	NAC domain
Pfam	PF02365	4.4E-29	12	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MESRRSKNLL APGFRFHPTD EELVRYYLRR KIIGKPLRFD AISEIDIYKV EPWDLPGMSR 60 LKTRDLEWYF FSMLDKKHGN GAKTNRATER GYWKTTGKDR AVHHKSKVVG MKKTLVYHSG 120 RAPKGQRTNW VMHEYKLIDE ELDKAGIAQG NGGRLKINCE LCFLSGS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-45	10	137	15	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269\|PubMed:22313226, ECO:0000269\|PubMed:24323506, ECO:0000269\|PubMed:25219309, ECO:0000269\|Ref.6}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|PubMed:22313226, ECO:0000269\|PubMed:25219309}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975444	1e-107	HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBank	HG975517	1e-107	HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016454006.1	1e-123	PREDICTED: NAC domain-containing protein 53-like
Refseq	XP_016454007.1	1e-123	PREDICTED: NAC domain-containing protein 53-like
Swissprot	Q949N0	9e-78	NAC53_ARATH; NAC domain-containing protein 53
TrEMBL	A0A1S3YPP4	1e-121	A0A1S3YPP4_TOBAC; NAC domain-containing protein 53-like
STRING	XP_009625486.1	1e-104	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA24126	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G10500.1	4e-80	NAC domain containing protein 53

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Gladman NP,Marshall RS,Lee KH,Vierstra RD The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis. Plant Cell, 2016. 28(6): p. 1279-96 [PMID:27194708] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590]