![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016454006.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 167aa MW: 19416.4 Da PI: 10.4108 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 173.6 | 6e-54 | 10 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
l+pGfrFhPtdeelv +yL++k+ gk+l++ ++i+e+diykvePwdLp +++k+++ ewyfFs dkk+ +g ++nrat++gyWk+tgkd++v+
XP_016454006.1 10 LAPGFRFHPTDEELVRYYLRRKIIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSMLDKKHGNGAKTNRATERGYWKTTGKDRAVH 103
579*************************99.99***************6347788888************************************* PP
NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ k+++vg+kktLv+++grapkg++t+Wvmhey+l
XP_016454006.1 104 H-KSKVVGMKKTLVYHSGRAPKGQRTNWVMHEYKL 137
*.999****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.92E-58 | 8 | 144 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 52.905 | 10 | 167 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.4E-29 | 12 | 137 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 167 aa Download sequence Send to blast |
MESRRSKNLL APGFRFHPTD EELVRYYLRR KIIGKPLRFD AISEIDIYKV EPWDLPGMSR 60 LKTRDLEWYF FSMLDKKHGN GAKTNRATER GYWKTTGKDR AVHHKSKVVG MKKTLVYHSG 120 RAPKGQRTNW VMHEYKLIDE ELDKAGIAQG NGGRLKINCE LCFLSGS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 3e-45 | 10 | 137 | 15 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975444 | 1e-107 | HG975444.1 Solanum pennellii chromosome ch05, complete genome. | |||
| GenBank | HG975517 | 1e-107 | HG975517.1 Solanum lycopersicum chromosome ch05, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016454006.1 | 1e-123 | PREDICTED: NAC domain-containing protein 53-like | ||||
| Refseq | XP_016454007.1 | 1e-123 | PREDICTED: NAC domain-containing protein 53-like | ||||
| Swissprot | Q949N0 | 9e-78 | NAC53_ARATH; NAC domain-containing protein 53 | ||||
| TrEMBL | A0A1S3YPP4 | 1e-121 | A0A1S3YPP4_TOBAC; NAC domain-containing protein 53-like | ||||
| STRING | XP_009625486.1 | 1e-104 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA24126 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G10500.1 | 4e-80 | NAC domain containing protein 53 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




