![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016464336.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10671.3 Da PI: 8.7899 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 29.3 | 2e-09 | 32 | 71 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++++E++l+++ +k+ G + W +Ia +++ gRt++++ +w
XP_016464336.1 32 MSKQEEDLIYRMHKLVGDR-WGLIAGRIP-GRTAEEIERFWI 71
689**************99.*********.*********995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 7.6E-7 | 28 | 76 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.52E-6 | 31 | 70 | No hit | No description |
| Pfam | PF00249 | 1.1E-8 | 32 | 71 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.3E-11 | 33 | 71 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 6.144 | 33 | 70 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 3.51E-8 | 33 | 72 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MDQNLHHQPK LMHHRCCSHE EVNSMEWEFI SMSKQEEDLI YRMHKLVGDR WGLIAGRIPG 60 RTAEEIERFW IMKHSDGFAN KRRQLRKV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC238926 | 3e-34 | AC238926.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-330o5 map 1, complete sequence. | |||
| GenBank | HG975440 | 3e-34 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
| GenBank | HG975513 | 3e-34 | HG975513.1 Solanum lycopersicum chromosome ch01, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009623671.1 | 7e-61 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Refseq | XP_009761639.1 | 7e-61 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Refseq | XP_016464336.1 | 7e-61 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Refseq | XP_016502110.1 | 7e-61 | PREDICTED: MYB-like transcription factor ETC3 | ||||
| Refseq | XP_019252948.1 | 7e-61 | PREDICTED: MYB-like transcription factor ETC3 isoform X2 | ||||
| Swissprot | Q8GV05 | 7e-33 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A1S4CLV6 | 2e-59 | A0A1S4CLV6_TOBAC; MYB-like transcription factor ETC3 | ||||
| TrEMBL | A0A1U7VH58 | 2e-59 | A0A1U7VH58_NICSY; MYB-like transcription factor ETC3 | ||||
| STRING | XP_009761639.1 | 3e-60 | (Nicotiana sylvestris) | ||||
| STRING | XP_009623671.1 | 3e-60 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA11707 | 18 | 24 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 3e-35 | MYB_related family protein | ||||




