PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016478805.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 108aa MW: 12429.2 Da PI: 10.0132

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016478805.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	80.1	1.5e-25	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n rqvtfskR+ g++KKA+EL +LCda+v v ifsstg+lyeyss XP_016478805.1 10 RIDNPASRQVTFSKRKSGLIKKAKELAILCDAQVGVTIFSSTGRLYEYSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.45	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	9.8E-35	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.46E-38	2	77	No hit	No description
PRINTS	PR00404	2.1E-26	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.67E-31	3	86	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.1E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MARGKIAIRR IDNPASRQVT FSKRKSGLIK KAKELAILCD AQVGVTIFSS TGRLYEYSSS 60 SMKSIFDRYN EEKEHHQLLT PSSAAKLWRT EAERLRQQME DLQENYSC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-21	1	82	1	82	MEF2C
5f28_B	1e-21	1	82	1	82	MEF2C
5f28_C	1e-21	1	82	1	82	MEF2C
5f28_D	1e-21	1	82	1	82	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor.
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016478805.1	6e-76	PREDICTED: MADS-box transcription factor 23-like isoform X3
Swissprot	Q6EP49	9e-46	MAD27_ORYSJ; MADS-box transcription factor 27
Swissprot	Q6VAM4	6e-46	MAD23_ORYSJ; MADS-box transcription factor 23
Swissprot	Q9SZJ6	9e-46	AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBL	A0A1S4AQG2	1e-74	A0A1S4AQG2_TOBAC; MADS-box transcription factor 23-like isoform X3
STRING	XP_009618485.1	3e-72	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37940.1	4e-48	AGAMOUS-like 21

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364] Yu LH, et al. Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression. Mol Plant, 2017. 10(6): p. 834-845 [PMID:28438576] Qu Y, et al. Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis. J. Exp. Bot., 2017. 68(17): p. 4851-4867 [PMID:28992128] Sun CH, et al. Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis. Plant Sci., 2018. 266: p. 27-36 [PMID:29241564]