PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016484162.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

WRKY

Protein Properties

Length: 140aa MW: 16486.3 Da PI: 8.6736

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016484162.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	102.8	1.9e-32	66	123	1	58
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh XP_016484162.1 66 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNH 123 59******************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	8.0E-34	51	124	IPR003657	WRKY domain
SuperFamily	SSF118290	1.18E-28	58	124	IPR003657	WRKY domain
PROSITE profile	PS50811	29.608	61	123	IPR003657	WRKY domain
SMART	SM00774	6.7E-37	66	125	IPR003657	WRKY domain
Pfam	PF03106	3.0E-25	67	123	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 140 aa Download sequence Send to blast
MEGDHQERVE TLDPKAIIDQ NCSGNASDGN NSWWRSSPSE KGKVKVRRKL REPRFCFQTR 60 SDIDVLDDGY KWRKYGQKVV KNSLHPRSYY RCTHSNCRVK KRVERLSEDC RMVITTYEGR 120 HNHYPCDDSN SSENDCFSSF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-27	57	123	8	74	Probable WRKY transcription factor 4
2lex_A	4e-27	57	123	8	74	Probable WRKY transcription factor 4
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	44	50	KVRRKLR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016484162.1	1e-101	PREDICTED: probable WRKY transcription factor 12 isoform X2
Swissprot	Q93WY4	1e-65	WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBL	A0A1S4B5P0	1e-100	A0A1S4B5P0_TOBAC; probable WRKY transcription factor 12 isoform X2
STRING	XP_009604138.1	3e-95	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G44745.1	5e-68	WRKY family protein

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Yang L, et al. PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa. Sci Rep, 2016. 6: p. 18643 [PMID:26819184] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Han Y, et al. WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 149-159 [PMID:30617455]