![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016491740.1 | ||||||||
| Common Name | NtabSPL3a | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 133aa MW: 15270 Da PI: 8.6211 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 140.5 | 4.6e-44 | 49 | 124 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqve+C+ad++ ak yhrrhkvCe+hskapvvl+sg++qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk++
XP_016491740.1 49 CQVEQCTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLPEFDEAKRSCRRRLAGHNERRRKTS 124
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 8.1E-58 | 1 | 133 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.8E-36 | 42 | 110 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.641 | 46 | 123 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 9.81E-41 | 47 | 127 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 9.1E-34 | 49 | 122 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 133 aa Download sequence Send to blast |
MEDNKWEGKR SMNEAEEEHE NAEEDNKRKR VLTLSGRNLS GGGPALPSCQ VEQCTADMAG 60 AKPYHRRHKV CEFHSKAPVV LISGIQQRFC QQCSRFHQLP EFDEAKRSCR RRLAGHNERR 120 RKTSYDSHGE SSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 4e-40 | 40 | 122 | 2 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LC072722 | 0.0 | LC072722.1 Nicotiana tabacum NtabSPL3a mRNA for squamosa promoter binding protein NtabSPL3a, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009763062.1 | 6e-96 | PREDICTED: squamosa promoter-binding protein 1-like isoform X2 | ||||
| Refseq | XP_016491740.1 | 6e-96 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
| Swissprot | Q38741 | 8e-55 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A125SZM9 | 1e-94 | A0A125SZM9_TOBAC; Squamosa promoter-binding-like protein | ||||
| TrEMBL | A0A1U7V4D5 | 1e-94 | A0A1U7V4D5_NICSY; Squamosa promoter-binding-like protein | ||||
| STRING | XP_009763061.1 | 3e-83 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 3e-44 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 107811347 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




