![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016492835.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 170aa MW: 18885.2 Da PI: 8.4109 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 123.2 | 8.8e-39 | 54 | 111 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
XP_016492835.1 54 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 111
7899****************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-29 | 53 | 111 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 4.4E-32 | 56 | 111 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.258 | 58 | 112 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 60 | 96 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010214 | Biological Process | seed coat development | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 170 aa Download sequence Send to blast |
MAQVQESRIS QGIKLFGATI QVQAKQAAKG LDHHQQPNKV DHDHDIDEDQ EKKPDKIIPC 60 PRCKSMETKF CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKA KPPCGGSDGD 120 MAAGLSDGCF FDVTNHGNIH QLDFDGVVAE EWHLFPAAKR RRSTSGSQSC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00166 | DAP | Transfer from AT1G29160 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC215388 | 3e-94 | AC215388.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0122E16, complete sequence. | |||
| GenBank | HG975514 | 3e-94 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009794806.1 | 1e-126 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
| Refseq | XP_016492835.1 | 1e-126 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
| Swissprot | P68350 | 2e-50 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | A0A1S4BVE1 | 1e-125 | A0A1S4BVE1_TOBAC; dof zinc finger protein DOF1.5-like | ||||
| TrEMBL | A0A1U7XYV0 | 1e-125 | A0A1U7XYV0_NICSY; dof zinc finger protein DOF1.5-like | ||||
| STRING | XP_009794806.1 | 1e-126 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA7240 | 22 | 32 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 8e-53 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




