![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_016652841.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 129aa MW: 14764 Da PI: 10.1847 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 133.8 | 1.2e-41 | 15 | 129 | 1 | 115 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95
lppGf+FhP+deel+v+yL++kv +++l++ + i+e+d+yk++Pw+Lp+++ +e+ewyfFs+rd+ky++g r+nra++sgyWka +dk++l++
XP_016652841.1 15 LPPGFKFHPSDEELIVHYLRNKVISHPLPA-QLITEIDLYKYNPWELPNNALFGEDEWYFFSPRDRKYPNGVRPNRAAASGYWKAASSDKPILTS 108
79****************************.89***************87778999************************************998 PP
NAM 96 .kgelvglkktLvfykgrapk 115
+ + +g+kk Lvfy+grapk
XP_016652841.1 109 rGLKRIGVKKALVFYTGRAPK 129
56677*************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.48E-47 | 11 | 129 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 46.693 | 15 | 129 | IPR003441 | NAC domain |
| Pfam | PF02365 | 6.0E-21 | 16 | 125 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 129 aa Download sequence Send to blast |
MEKVSTFPSS ALQLLPPGFK FHPSDEELIV HYLRNKVISH PLPAQLITEI DLYKYNPWEL 60 PNNALFGEDE WYFFSPRDRK YPNGVRPNRA AASGYWKAAS SDKPILTSRG LKRIGVKKAL 120 VFYTGRAPK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swm_B | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swm_C | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swm_D | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swp_A | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swp_B | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swp_C | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| 3swp_D | 8e-53 | 15 | 129 | 20 | 132 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_016652841.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016652841.1 | 2e-91 | PREDICTED: NAC transcription factor 56-like | ||||
| Swissprot | A0SPJ6 | 3e-56 | NAMB2_TRITD; NAC transcription factor NAM-B2 | ||||
| TrEMBL | M5W733 | 3e-85 | M5W733_PRUPE; Uncharacterized protein | ||||
| STRING | EMJ09136 | 5e-86 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2416 | 29 | 81 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 2e-58 | NAC domain containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




