![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zjn_sc00016.1.g02470.1.sm.mkhc | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 116aa MW: 12254.1 Da PI: 10.0782 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 95.1 | 3.1e-30 | 65 | 115 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien+ nrqvtf+kRr g+lKKA+ELSvLCdae+a+++fss+g+lyeys+
Zjn_sc00016.1.g02470.1.sm.mkhc 65 KRIENTPNRQVTFCKRRSGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 115
79***********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00404 | 4.4E-30 | 59 | 79 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 59 | 113 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.7E-26 | 60 | 115 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.6E-33 | 60 | 116 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.352 | 61 | 116 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 8.28E-35 | 62 | 116 | No hit | No description |
| Pfam | PF00319 | 9.6E-26 | 66 | 113 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-30 | 79 | 94 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-30 | 94 | 115 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MHIREMEAAP STDLMSAALT SVGLKQKDPL PSPGTGSVAA AASTAGAAEK AAAAAGNKGK 60 KVEIKRIENT PNRQVTFCKR RSGLLKKAYE LSVLCDAEIA LVVFSSRGRL YEYSNN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 3mu6_A | 3e-20 | 60 | 114 | 3 | 57 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 3e-20 | 60 | 114 | 3 | 57 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 3e-20 | 60 | 114 | 3 | 57 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 3e-20 | 60 | 114 | 3 | 57 | Myocyte-specific enhancer factor 2A |
| 6c9l_A | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 4e-20 | 60 | 114 | 4 | 58 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ430631 | 2e-69 | AJ430631.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m2 gene). | |||
| GenBank | KJ728313 | 2e-69 | KJ728313.1 Zea mays clone pUT6593 MADS transcription factor (MADS35) mRNA, partial cds. | |||
| GenBank | MZEAGAMOU | 2e-69 | L81162.2 Zea mays AGAMOUS-like protein (AGAMOUS) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004960599.1 | 2e-44 | MADS-box transcription factor 58 | ||||
| Swissprot | Q2V0P1 | 4e-37 | MAD58_ORYSJ; MADS-box transcription factor 58 | ||||
| TrEMBL | A0A368QCB7 | 4e-43 | A0A368QCB7_SETIT; Uncharacterized protein | ||||
| TrEMBL | K3ZAE5 | 4e-44 | K3ZAE5_SETIT; Uncharacterized protein | ||||
| STRING | Si023516m | 7e-45 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18960.1 | 2e-31 | MIKC_MADS family protein | ||||




