![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zjn_sc00022.1.g02250.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 95aa MW: 10819.6 Da PI: 9.1718 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.9 | 4.3e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WTteEd++lv +G +W+++++ g+ R++k+c++rw +yl
Zjn_sc00022.1.g02250.1.sm.mk 14 KGPWTTEEDQKLVTFLLSHGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.5E-22 | 5 | 62 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 20.991 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.5E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.72E-20 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.61E-10 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 9.7E-7 | 63 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MGRQPCCEKV GLKKGPWTTE EDQKLVTFLL SHGHCCWRLV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SDEEEALVID LHAQLGNRSV RTTST |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-16 | 12 | 88 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU964620 | 1e-106 | EU964620.1 Zea mays clone 280394 odorant 1 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001149774.1 | 5e-57 | odorant 1 protein | ||||
| Swissprot | Q9C7U7 | 3e-51 | MYB20_ARATH; Transcription factor MYB20 | ||||
| TrEMBL | A0A3L6F8W0 | 1e-55 | A0A3L6F8W0_MAIZE; Protein ODORANT1 | ||||
| TrEMBL | B6TI05 | 1e-55 | B6TI05_MAIZE; Odorant 1 protein | ||||
| TrEMBL | K7U498 | 2e-55 | K7U498_MAIZE; Putative MYB DNA-binding domain superfamily protein | ||||
| STRING | Sb04g028850.1 | 1e-57 | (Sorghum bicolor) | ||||
| STRING | GRMZM2G055158_P01 | 3e-56 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP79 | 38 | 563 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G12350.1 | 7e-54 | myb domain protein 42 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




