![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zjn_sc00026.1.g01710.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 95aa MW: 10477.1 Da PI: 10.1516 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 102.5 | 1.5e-32 | 43 | 93 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
Zjn_sc00026.1.g01710.1.sm.mk 43 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 93
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.4E-41 | 35 | 94 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.473 | 35 | 95 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.54E-41 | 36 | 93 | No hit | No description |
| SuperFamily | SSF55455 | 3.92E-30 | 36 | 94 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-34 | 37 | 57 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 37 | 91 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.0E-27 | 44 | 91 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-34 | 57 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-34 | 72 | 93 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MLNMMSDLSC GPSAKGKEQP APANSGPSAG MSEKLGRGKI EIKRIENSTN RQVTFCKRRN 60 GLLKKAYELS VLCDAEVALI VFSSRGRLYE YANHR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ430637 | 2e-63 | AJ430637.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m23 gene). | |||
| GenBank | EU960810 | 2e-63 | EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008654205.1 | 1e-46 | AGAMOUS-like protein isoform X1 | ||||
| Swissprot | P29381 | 3e-36 | AGL1_ARATH; Agamous-like MADS-box protein AGL1 | ||||
| TrEMBL | A0A0A8XZ73 | 1e-50 | A0A0A8XZ73_ARUDO; Uncharacterized protein | ||||
| TrEMBL | A0A0A9TLG6 | 1e-50 | A0A0A9TLG6_ARUDO; Uncharacterized protein | ||||
| STRING | GRMZM2G359952_P01 | 5e-46 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G58780.2 | 2e-39 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




