![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zjn_sc00029.1.g05950.1.sm.mk | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 103aa MW: 11296.7 Da PI: 8.4987 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 77.2 | 2.7e-24 | 14 | 72 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+ye+++d++++ ++ w+ g+sfvv ++ ef +++LpkyFkh+nf+SFvRQLn+Y
Zjn_sc00029.1.g05950.1.sm.mk 14 FLSKTYEMVDDRATDAVVAWTPPGTSFVVANQAEFCRDLLPKYFKHNNFSSFVRQLNTY 72
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 7.0E-27 | 9 | 76 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 2.86E-23 | 9 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 6.3E-27 | 10 | 98 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-16 | 14 | 37 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.7E-21 | 14 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-16 | 52 | 64 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-16 | 65 | 77 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MEGGGGGGSS LPPFLSKTYE MVDDRATDAV VAWTPPGTSF VVANQAEFCR DLLPKYFKHN 60 NFSSFVRQLN TYVSERHPSP LATFVPHRTR FLGRVSAADF IGA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 4e-22 | 4 | 72 | 19 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 4e-22 | 4 | 72 | 19 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 4e-22 | 4 | 72 | 19 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT203456 | 7e-94 | KT203456.1 Paspalum vaginatum clone SpCT4 hypothetical protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025816816.1 | 2e-42 | heat stress transcription factor A-4b isoform X2 | ||||
| Swissprot | Q94J16 | 7e-35 | HFA4B_ORYSJ; Heat stress transcription factor A-4b | ||||
| TrEMBL | A0A1E5V8K7 | 2e-44 | A0A1E5V8K7_9POAL; Heat stress transcription factor A-4b | ||||
| STRING | Sb03g034630.1 | 8e-42 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17750.1 | 2e-28 | heat shock factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




