PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zjn_sc02841.1.g00010.1.sm.mk

Organism

Zoysia japonica

Taxonomic ID

309978

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

WRKY

Protein Properties

Length: 78aa MW: 8803.8 Da PI: 6.9381

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zjn_sc02841.1.g00010.1.sm.mk	genome	ZGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	57	3.9e-18	8	45	22	59
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +sYYrCt++gC+vkk+v+r ++d vv++tYeg+H+h+ Zjn_sc02841.1.g00010.1.sm.mk 8 KSYYRCTHQGCNVKKQVQRLSKDDGVVVTTYEGTHTHP 45 79***********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00774	1.3E-10	4	46	IPR003657	WRKY domain
SuperFamily	SSF118290	1.7E-15	7	46	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	2.8E-16	7	45	IPR003657	WRKY domain
Pfam	PF03106	3.5E-14	7	45	IPR003657	WRKY domain
PROSITE profile	PS50811	16.363	8	47	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MATVFDQKSY YRCTHQGCNV KKQVQRLSKD DGVVVTTYEG THTHPIEKSN DNFEHILTQM 60 QIYSGVGGSD FSSSPMFP

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012619	4e-48	CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBank	CT828238	4e-48	CT828238.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA112H02, full insert sequence.
GenBank	KJ728200	4e-48	KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004979296.1	2e-37	probable WRKY transcription factor 75
Swissprot	Q9FYA2	7e-28	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A1E5W1J8	1e-36	A0A1E5W1J8_9POAL; Putative WRKY transcription factor 75
STRING	Pavir.J12348.1.p	3e-37	(Panicum virgatum)
STRING	Si026859m	6e-37	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1100	38	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	3e-30	WRKY DNA-binding protein 75

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]