 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc00043.1.g00160.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 75aa MW: 8225.72 Da PI: 9.0051 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 42.1 | 2.7e-13 | 5 | 35 | 99 | 129 |
NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129
+vg+kktLvfy gr+p gekt+W+mheyrle
Zmw_sc00043.1.g00160.1.sm.mk 5 VVGMKKTLVFYIGRSPWGEKTEWIMHEYRLE 35
69***************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 16.842 | 1 | 62 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 1.44E-13 | 4 | 40 | IPR003441 | NAC domain |
| Pfam | PF02365 | 7.1E-7 | 6 | 34 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MMPAVVGMKK TLVFYIGRSP WGEKTEWIMH EYRLEGSGKF CCPSSSSNIS KAAMTLCCGN 60 MQALAKHTMH GPVAT |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022679478.1 | 1e-15 | protein CUP-SHAPED COTYLEDON 1 | ||||
| Refseq | XP_025801540.1 | 7e-16 | NAC domain-containing protein 79-like | ||||
| TrEMBL | A0A1E5V4C4 | 5e-16 | A0A1E5V4C4_9POAL; NAC domain-containing protein 79 | ||||
| STRING | Si030284m | 5e-15 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP36207 | 3 | 4 |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|