PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc00124.1.g00240.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

Dof

Protein Properties

Length: 177aa MW: 18983.1 Da PI: 8.3693

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc00124.1.g00240.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	128.5	1.9e-40	99	159	2	62
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s Zmw_sc00124.1.g00240.1.am.mkhc 99 PDKILPCPRCNSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSAS 159 7899*****************************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	4.0E-27	96	148	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	6.0E-33	101	157	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.929	103	157	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	105	141	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MAECRAGGGG GGDGLIKLFG KTIPVPEAAT AVGDADRDLQ QSGSNTTEPK GHETTLPDST 60 GSPSQQGVTD TEESSAENNS LADQQQGDPT KQKENLKKPD KILPCPRCNS MDTKFCYYNN 120 YNINQPRHFC KNCQRYWTAG GAMRNVPVGA GRRKSKSASA ASHFLQRVRA ALPVDPL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. A flanking TGT sequence contributes to the specificity of binding. Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The DNA-binding ability is not modulated by 'GIGANTEA' but the stability of CDF1 is controlled by the proteasome-dependent pathway. Ubiquitinated by the SCF(ADO3) E3 ubiquitin ligase complex. Binds to the FT promoter in the morning. {ECO:0000269\|PubMed:16002617, ECO:0000269\|PubMed:19619493, ECO:0000269\|PubMed:22628657}.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation at the protein level, but not at the mRNA level. Strongly decreased expression during the dark phase. Accumulates at high levels at the beginning of the day. {ECO:0000269\|PubMed:16002617}.
UniProt	INDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269\|PubMed:19619493}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004985552.1	2e-97	cyclic dof factor 1
Swissprot	Q8LFV3	2e-42	CDF3_ARATH; Cyclic dof factor 3
Swissprot	Q8W1E3	2e-43	CDF1_ARATH; Cyclic dof factor 1
TrEMBL	A0A3L6S6E2	1e-103	A0A3L6S6E2_PANMI; Cyclic dof factor 1-like
STRING	Pavir.Ia04317.1.p	1e-98	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2099	37	93

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Seaton DD, et al. Linked circadian outputs control elongation growth and flowering in response to photoperiod and temperature. Mol. Syst. Biol., 2015. 11(1): p. 776 [PMID:25600997] Corrales AR, et al. Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis. Plant Cell Environ., 2017. 40(5): p. 748-764 [PMID:28044345] Renau-Morata B, et al. Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions. Front Plant Sci, 2017. 8: p. 660 [PMID:28515731] Goralogia GS, et al. CYCLING DOF FACTOR 1 represses transcription through the TOPLESS co-repressor to control photoperiodic flowering in Arabidopsis. Plant J., 2017. 92(2): p. 244-262 [PMID:28752516] Henriques R, et al. The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering. New Phytol., 2017. 216(3): p. 854-867 [PMID:28758689]