PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc00502.1.g00060.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 105aa MW: 11592.6 Da PI: 10.8965

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc00502.1.g00060.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98	3.8e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s Zmw_sc00502.1.g00060.1.sm.mk 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.9E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.777	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-29	3	67	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.8E-32	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.85E-38	3	59	No hit	No description
Pfam	PF00319	8.0E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.8E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.8E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MVRGKTELKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA 60 ARCVSRLVSL PHESADCKSI RTPFRSVSNS RSPLLPVVAT DALVV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	3e-18	1	74	1	78	MEF2 CHIMERA
6byy_B	3e-18	1	74	1	78	MEF2 CHIMERA
6byy_C	3e-18	1	74	1	78	MEF2 CHIMERA
6byy_D	3e-18	1	74	1	78	MEF2 CHIMERA
6bz1_A	4e-18	1	74	1	78	MEF2 CHIMERA
6bz1_B	4e-18	1	74	1	78	MEF2 CHIMERA
6bz1_C	4e-18	1	74	1	78	MEF2 CHIMERA
6bz1_D	4e-18	1	74	1	78	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001168784.1	7e-36	uncharacterized LOC100382583
Refseq	XP_008658827.1	8e-36	uncharacterized protein LOC100382583 isoform X1
Swissprot	P0C5B2	1e-35	MAD56_ORYSJ; MADS-box transcription factor 56
TrEMBL	A0A1D6P8V7	1e-35	A0A1D6P8V7_MAIZE; Agamous-like MADS-box protein AGL14
STRING	Pavir.J22336.1.p	3e-36	(Panicum virgatum)
STRING	GRMZM2G070034_P01	3e-35	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Bai Z, et al. The impact and origin of copy number variations in the Oryza species. BMC Genomics, 2016. 17: p. 261 [PMID:27025496] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Han Z,Zhang B,Zhao H,Ayaad M,Xing Y Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice. Front Plant Sci, 2016. 7: p. 1270 [PMID:27621738]