![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc00505.1.g00040.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 118aa MW: 12741.5 Da PI: 11.1114 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 76.3 | 5.5e-24 | 26 | 85 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
Fl+k+++++e+++++e+isw e+g+sfvv+++ efa+++Lp +Fkh nf+SFvRQLn+Y
Zmw_sc00505.1.g00040.1.am.mk 26 FLTKTHQMVEERATDEVISWAEQGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYV 85
9**********************************************************4 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 7.2E-25 | 22 | 113 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.35E-21 | 22 | 88 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Gene3D | G3DSA:1.10.10.10 | 3.4E-26 | 22 | 91 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 2.5E-20 | 26 | 85 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.6E-13 | 26 | 49 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.6E-13 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.6E-13 | 77 | 89 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MAGATAAGRP KGSGGRGGGG GGPAPFLTKT HQMVEERATD EVISWAEQGR SFVVWKPVEF 60 ARDLLPLHFK HCNFSSFVRQ LNTYVPFVVT KRNIAAQASC VGQQRKTKII ARAGRGDN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1hks_A | 1e-15 | 19 | 84 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| 1hkt_A | 1e-15 | 19 | 84 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 13 | 21 | GGRGGGGGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150318.1 | 2e-41 | uncharacterized protein LOC100283948 | ||||
| Swissprot | Q67TP9 | 1e-36 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
| TrEMBL | B6TNF2 | 4e-40 | B6TNF2_MAIZE; Heat shock factor protein 4 | ||||
| STRING | GRMZM2G139535_P02 | 1e-42 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




