PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zmw_sc00539.1.g00480.1

Organism

Zoysia matrella

Taxonomic ID

38722

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

HSF

Protein Properties

Length: 118aa MW: 13100.8 Da PI: 9.0223

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zmw_sc00539.1.g00480.1	genome	ZGD	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	85.2	8.7e-27	41	103	2	64
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 Fl+k+y++++d++++++isw+++g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y ++ Zmw_sc00539.1.g00480.1.sm.mk 41 FLTKTYQLVDDPAVNDIISWNDDGSAFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYVSRR 103 9**********************************************************6655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.4E-29	32	105	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.8E-30	37	117	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.27E-25	38	106	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	3.8E-23	41	105	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.0E-18	41	64	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.0E-18	79	91	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.0E-18	92	104	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
MAAEQPAGEP SPPPLPSAHP PAPAERAPSP LASQRSVPTP FLTKTYQLVD DPAVNDIISW 60 NDDGSAFVVW RPAEFARDLL PKYFKHNNFS SFVRQLNTYV SRRVATSFIF SHLVSLRP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	7e-19	20	105	15	93	Heat shock factor protein 1
5d5v_B	7e-19	20	105	15	93	Heat shock factor protein 1
5d5v_D	7e-19	20	105	15	93	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021319939.1	3e-43	heat stress transcription factor B-2b-like
Swissprot	Q652B0	2e-40	HFB2C_ORYSJ; Heat stress transcription factor B-2c
Swissprot	Q6Z9C8	6e-41	HFB2B_ORYSJ; Heat stress transcription factor B-2b
TrEMBL	A0A1Z5RAH8	7e-42	A0A1Z5RAH8_SORBI; Uncharacterized protein
TrEMBL	A0A1Z5RAL7	7e-42	A0A1Z5RAL7_SORBI; Uncharacterized protein
STRING	GRMZM2G098696_P02	7e-42	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP121	37	394

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xiang J, et al. Heat shock factor OsHsfB2b negatively regulates drought and salt tolerance in rice. Plant Cell Rep., 2013. 32(11): p. 1795-806 [PMID:23949687] Rerksiri W,Zhang X,Xiong H,Chen X Expression and promoter analysis of six heat stress-inducible genes in rice. ScientificWorldJournal, 2013. 2013: p. 397401 [PMID:24459431]