PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01004.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 149aa    MW: 16469.8 Da    PI: 8.523
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01004.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH18.14.7e-06771161554
                                   HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                           HLH  15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                                   +i +  ++L+ llP+a   +s ++  a +L++++ YI+sL
  Zmw_sc01004.1.g00060.1.am.mk  77 QISDLVAKLQVLLPEARLRSSDRVPSARVLQETCSYIRSL 116
                                   789999*********8899999****************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.35662116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.109.8E-676130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474594.58E-776137IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MLPDRSELME RDMPTLSCQA PRDSGRGRQR IRLRPPAPLL AHCSPLIDVH SGEGSEMSSR  60
RPRSRASGGA ARISDEQISD LVAKLQVLLP EARLRSSDRV PSARVLQETC SYIRSLHREV  120
DDLSDRLSEL LATSDVSTAQ AAIIRSLLM
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
UniProtAtypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983143.12e-42transcription factor ILI7
RefseqXP_025797606.12e-42transcription factor ILI7
SwissprotA2Z7301e-39ILI7_ORYSI; Transcription factor ILI7
SwissprotB8APB51e-39ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR21e-39ILI6_ORYSJ; Transcription factor ILI6
SwissprotQ338G61e-39ILI7_ORYSJ; Transcription factor ILI7
TrEMBLA0A2S3IMI64e-41A0A2S3IMI6_9POAL; Uncharacterized protein
TrEMBLA0A2T7C6W64e-41A0A2T7C6W6_9POAL; Uncharacterized protein
TrEMBLA0A3L6SFA94e-41A0A3L6SFA9_PANMI; Transcription factor ILI7
TrEMBLK4AH624e-41K4AH62_SETIT; Uncharacterized protein
STRINGPavir.Ia01776.1.p3e-45(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]