![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Zmw_sc01462.1.g00290.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 107aa MW: 11650.5 Da PI: 10.1644 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 87.8 | 6.1e-28 | 42 | 91 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+++ rqvtfskRr g+lKKA+ELSvLCdaev +i+fs++g+ly ++s
Zmw_sc01462.1.g00290.1.am.mk 42 RIEDTTSRQVTFSKRRSGLLKKAFELSVLCDAEVGLIVFSPRGRLYQFAS 91
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 7.7E-35 | 33 | 92 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.875 | 33 | 93 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-28 | 35 | 55 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 35 | 89 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.45E-26 | 35 | 91 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-26 | 42 | 89 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.31E-33 | 43 | 91 | No hit | No description |
| PRINTS | PR00404 | 1.2E-28 | 55 | 70 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-28 | 70 | 91 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MVATAAMAAE AAPSPEGGDQ IVAEAPDGRK KLGRRGRREM RRIEDTTSRQ VTFSKRRSGL 60 LKKAFELSVL CDAEVGLIVF SPRGRLYQFA SAIEYVLPLL PCPSPST |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_A | 2e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 2e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 2e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 2e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 3e-18 | 28 | 92 | 1 | 59 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020261770.1 | 1e-29 | MADS-box transcription factor 50-like | ||||
| Swissprot | A2Z9Q7 | 7e-29 | MAD56_ORYSI; MADS-box transcription factor 56 | ||||
| Swissprot | P0C5B2 | 6e-29 | MAD56_ORYSJ; MADS-box transcription factor 56 | ||||
| TrEMBL | A0A1E5VTG7 | 2e-33 | A0A1E5VTG7_9POAL; MADS-box protein SOC1 | ||||
| STRING | XP_009375845.1 | 2e-28 | (Pyrus x bretschneideri) | ||||
| STRING | Si038299m | 9e-29 | (Setaria italica) | ||||
| STRING | Traes_1BL_F1D5BF5F8.2 | 1e-28 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




